McDonnell Genome Institute

Washington University

CircRNA

chr7|7585635|7606071|+|MIOS|ENST00000340080.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9366

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

8

Peptide

LDICLVGSGDLNLNVVAMALSGYTDEK

Amino Acids from 5' Exons

EIISMWQWLYRVIRMRRTPFGEKCVAHCDYSITRICVSCLHFQVKQDLTMEF,RSESQCGSNGFIGLYGEELPLERNVHTAITAKPVFVCHVCISDKNRILRWSF,DLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVL

Amino Acids from 3' Exons

EEPNQMKKWTARTKNPNLTTGLHGVIIAGTVDMLDICLVGS,RNQIRKSGLEQGQKISPIQLVYMVSLQARWTCWTYALVQ,GTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWF