McDonnell Genome Institute

Washington University

CircRNA

chr7|75555415|75559915|-|HIP1|ENST00000336926.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9226

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

NLLSSAALGLQSQR

Amino Acids from 5' Exons

ESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISCAGSA,NLCASLPKTNEKCFWWGPGRLRSRYKTPTSLKNLLSSAALGLQ,IYVPACQRPTKNASGGVQEGCGAGDTRRPEPARTSSHQLRWVC

Amino Acids from 3' Exons

SQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIE,ASGLCCSRATSASWKQIWPSSSTCGSRRPTTVNSCGQNWTSSGGSGRTPRRLSGACLRK,PAGCAAAEGPRQRAGSRSGRAAAPAAAGGRRLIPAGRTGRAQEAAGGHREGSAEPVDR