McDonnell Genome Institute

Washington University

CircRNA

chr7|74689123|74691111|+|GTF2I|ENST00000432143.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

3

Peptide

YWIMAQVAMSTLPVEDEESSESR

Amino Acids from 5' Exons

GSWPKLQCPPSPLKMRSPRRAGWWHSSCQLSSP,DHGPSCNVHPPRRGVLGEQDGGDIPHVSSRVH,IMAQVAMSTLPVEDEESSESRMVVTFLMSALESM

Amino Acids from 3' Exons

CKELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKY,VKNWPSPKPKWPALQCMKQTCLSSELKEDVLLSIPERIFKKILNI,RTGQVQSRSGLHCSVNRRVCRRNKRTCFCQYQKGFSKRFCKI