McDonnell Genome Institute

Washington University

CircRNA

chr7|74356409|74376822|+|CLIP2|ENST00000223398.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9814

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

10

Peptide

SRPCAPPSTPTYFQCPPK

Amino Acids from 5' Exons

VLPVPTQVWSLRAHPQSDPYRLPIYQPSQGQEDQAYGHGCVSTDPQSQQFLHQLRQLCGLLRGGSAQPQWP,YFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKKTKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGL,TSSAHPSLVSSRPSTKSVSASHLPAQPRPRRPSVWPWVCQHPTVPAVPPSAPSALWPPPWGVGPAAVA

Amino Acids from 3' Exons

LTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAAEILRLRERLLSASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQQATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKAVMEGIKMEHQLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLELQEAQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQRAEAQGKQEVESLREKLLVAENRLQAVEALCSSQHTH,PQWPRSRACCSWRRSSPCAEVKSRSSSSACCTRVPHLRTTQTPPRSCGYGSGCSRPARNTRGRVGCCGINTRRPRPTRRRWTSSARPTRSTHRRWRARTRFSRPPARTWGWTTGNPSWTRWPRTTRSPWRTSKPPTRAQAPSRRRSASRQWRASRWSTSWSWVTCRPSMTWRPPCTRRRRPCERSCRRPRRSWLGCSGTGGPSWRCKPASTGWSCRRPRTSAGMPSCVCTSWKNWTWSTGARRRLSSSSRSRSRWPRRRCWTTSGCSGQKPRANRRSRVCGRSSWWLRTDSRRSRPCAPPSTP,DHSGREVARAAAGGGAHPAPRNRGAPAVPVALGSPTSGPPRRRRDPAATGAAALGQQGTPEGEWGAAGIREGPEGLPGGGGQAPRGQREVRTGGGGPEGQGSAGHQREHGANGQLEIQAGLAGLGPPEVPGGPQSHPELGPRRPAEGDRRAEGSDGGHQDGAPAGAGLAGQAPGDRHAREGEGGPAREAAGGPGGAGWAAAALAGPAGGASQPAPAGAAGGPGPAPGCRAACARAGKTGRGVPGPGAGYRVPQGADLAGREEDVGLRAAAAGRSPGQTGGREFAGEAPGGEQTPGGRGPVLLPAHP