McDonnell Genome Institute

Washington University

CircRNA

chr7|73469516|73478569|-|BAZ1B|ENST00000339594.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9842

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

AGYMTALTTDSTITAK

Amino Acids from 5' Exons

ILALLRSSRIIHKRLGTQHLPIQPSLQRPHSLWGLLSS,YWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDEDYCPR,TGSSQMKFQDYSLKKAGYMTALTTDSTITAKTTQSLVMRITVLA

Amino Acids from 3' Exons

YMTLNPSTKRKNTGSPDRKPSKKSKTDNSSLSSPLNPKLWCHVHLKKSLSGSPLKVKNSKNSKSPEEHLEEMMKMMSPNKLHTNFHIPKKGPPAKKPGKHSDKPLKAKGRSKGILNGQKSTGNSKSPKKGLKTPKTKMKQMTLLDMAKGTQKMTRAPRNSGGTPRTSSKPHKHLPPAALHLIAYYKENKDREDKRSALSCVISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSEEQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRSDVQEESEGSDTDDNKDSAAFEDNEVQDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKERLAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMISAVKSRRLLAIQAKKEREIQEREMK,ILSTLLLRGRILDPQTGSPQRNPRQTTLLLVHHILSYGVTYTRSHVARHSKRTQRIPNLLKNIKKRCRPISCTLTFTFLKKAHLPRNQGSTVTSLRQRAEAKASMDRNPQGIPNLPKKDRLLKPKSRLCWIWPKARRRHEPHGILGVHLGPLVNLINICLLQPYTSLHTTKKTKTGRTRGAPCPVLSPKQLVFSLVKIELVSQKNCEVLFKNAMNFSTKRGGLLCLKNNGKNIKRNGRSKRSRKKPKNEERKKCLRDKNRSGMRTKSLAKTFQHSDWWIPLKGCPTRCLGMWPWWWNSAVILGYFYQMLSILLLLCPLWKPVQIRVAFYTLTGCWSSSYRPSYKMRQKTMVNWESCRKSPLCILFQSWCGSACADLMFRRKARAQTQMTIKIQLHLRIMRYKMSSKSWRPLNFLSRQRRSYRSQHCATGSSHTQCKTTWRPDSRCLQSCGRNGLLCRKKMIRREQRNRNGKKWKPKIKKMEKLRMGAKLIGKKKLSLSPKIQKLKTLVLRAEGCLPFKLRRNGKSRKEKK,YDSQPFYEEEYWIPRQEALKEIQDRQLFSFTTKSVMVSRTLEEVIEWLATQSEELKEFQISRTSRRNDEDDVAQAAHLSHSKRPTCQETREAQQAFEGKGQKQRHPEWTEIHREFQISQKRTEDSNQNEADDFVGYGQRHAEDDTSPTEFWGYTDLTSTSASCSPTPHCILQRKQRQGGQEERPVLCYLQNSSSSLRSSSPRRIAKSCSKTLTSRAQKEVGFYVRTTERIFEKETGGAEKEVEGKSQRTKRERNAEIRKTEAVGPRVNWQKPSSIQIGGYPRAAQHAVWGCGHGGGILELLFWATFTRCSVSYYCCVPYGSLECRGWLFIPQGVGHPLTDPPTRDSRRLWIGNEAVGNPLDSAFCFRAGAALLAQICSGGKRGLRHRQRFSCIGGTRVPRKAGDLIFADVRGEATDLDSTVPPDPHDILSARPHGDQTADVCRVVEGTACCVEGRKEESRETETERNGSQKRKWKSEWVRQNEKRNCEVAPSRYRSRHDCCEEQKVACHSSEGTGNPGKRNE