McDonnell Genome Institute

Washington University

CircRNA

chr7|67017852|67067403|+|TYW1|ENST00000359626.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9342

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

MCLLLAVGK

Amino Acids from 5' Exons

VGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTE,LAKMLTSGSGCLARIVVEGRATATWLKASTAALRPTSEHGRPSSSPSCRHFRKGRERSPVAATARKANVNLTNMAQRRGRKDLMSRMNCIIETP,WQKCQVALDAWRASCDESRGGRLRRGKQARQHGRLQSMEDQVHLPAAGTSERGEKEVLWRPLQERQMISPTWLRGEGGRISAGIASRHR

Amino Acids from 3' Exons

SMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCW,PCSEGEEVVTNTHSMELRAIAAWKPPRAWRVLINVSSVG,HAPRERRLLQTHILWNEPSLHGNHPELGVCMCLLLA