McDonnell Genome Institute

Washington University

CircRNA

chr7|66998064|67018143|+|TYW1|ENST00000359626.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9897

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

DTEILLR

Amino Acids from 5' Exons

ILLRIHGTSSHLYHYGTGFTFIWALLLALAFGFVSRLSSRR,SFCGYMGPLLTFNIIMDKQVLHLFGLCCHPLDLCPDCHQDA,PSADTWDLFSPLISLWINRFYIYLGFAVSISLWICVQIVIKTQ

Amino Acids from 3' Exons

VGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTE,LAKMLTSGSGCLARIVVEGRATATWLKASTAALRPTSEHGRPSSSPSCRHFRKGRERSPVAATARKANVNLTNMAQRRGRKDLMSRMNCIIETP,WQKCQVALDAWRASCDESRGGRLRRGKQARQHGRLQSMEDQVHLPAAGTSERGEKEVLWRPLQERQMISPTWLRGEGGRISAGIASRHR