McDonnell Genome Institute

Washington University

CircRNA

chr7|66783674|66799414|+|KCTD7|ENST00000503687.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9145

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

AITEIQEAK

Amino Acids from 5' Exons

KFRKQKLPVLPTGKPALKRIECLRSSNFSRPSTRQAKKSINRPSCFWKECITK,NSGSKSSQSFHKPANQHNGSVGVHRISQDLPQDRPRNLTDQAVFGRNALQK,IQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKR

Amino Acids from 3' Exons

SPALGYASDAVCPCRHPRSVYGGEGDH,ALRWVTPQMLCVPVNEDIPEVSDMVVKAIT,PCAGLRLRCCVSLLMKTSQKCLIWWRRSQ