McDonnell Genome Institute

Washington University

CircRNA

chr7|65979398|65980409|-|GUSB|ENST00000304895.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9408

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

21

Peptide

TVSGPTVDMPVPSSFNDISQDWR

Amino Acids from 5' Exons

VSQGLLCPEHIFLFQLRWTAAVCTSVHDTHHLHRHHRHHQRGARQ,YPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQDS,IPRVTLSRTHILTFSTTLDCSGLYFCTRHPPPTSMTSPSPPAWSKTV

Amino Acids from 3' Exons

SGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVVLRIGSAHSYAIV,QAPPWTCQFPPASMTSARTGVCGILSAGCGTNGRSCRSDGPRTCAQEWCGLAVPIPMPS,RPHRGHASSLQLQHQPGLASAAFCRLGVVRTGGDPAGAMDPGPAHKSGAEDWQCPFLCHR