McDonnell Genome Institute

Washington University

CircRNA

chr7|5641153|5752979|-|RNF216|ENST00000389900.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.97

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

18

Peptide

CSLWTDPTSGSISEMGPSPYLTPQMR

Amino Acids from 5' Exons

RKNDCCPHKMPQVWDWPHQIRLQPHVLPLWCPDVLPLSSFYWIPFLPTSPLTRSPLPGVFKMLSLDRSH,EEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPT,KKKLLPALENATSVGLASSNLKAATACLAAVVPRCATSVEFLLMDMTISANIPAHQEPLARSVQDALSGPIP

Amino Acids from 3' Exons

SGSISEMGPSPYLTPQMRKGFQCWSPQLLSSMKKRTWMMMSSQ,VDQSPRWAHHHILLRGKDSNAGHPSSSAARRGPGCHPDR,WINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLDDDVILTE