McDonnell Genome Institute

Washington University

CircRNA

chr7|5529160|5529663|-|ACTB|ENST00000477812.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9913

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

20

Peptide

MTQLTMDDDIAALVVDNGSGMCK

Amino Acids from 5' Exons

LTMDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQVGELAGWGSPGSGREARALSLHRSLPVSGVGAAPVLRASCPFLPRAWWAWVRRIPMWATRPRAREASSPSTPSSTASSPTGTTWRKSGTTPSTMSCVWLPRSTPCCPRPPTPRPTARRP,SPWMMISPRSSSTTAPACARPASRATMPPGPSSPPSWGAPGTRGSWLGGAAPGAGGRQGRFLCTGASRFPGWGLRPCSGLLVLSFPGRDGGHGSEGFLCGRRGPEQERHPHPEVPHRARHRHQLGRHGENLAPHLLQAACGSRGAPRAADRGPPEPQGQPREDDP,HHGYRRARRRQRLRHVQGRLRGRRCPPGRLPLHRGAPQAPGRGAGWVGQPRERAGGKGAFSAQEPPGFRGGGCARAQGFLSFPSQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ

Amino Acids from 3' Exons

LTMDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQVGELAGWGSPGSGREARALSLHRSLPVSGVGAAPVLRASCPFLPRAWWAWVRRIPMWATRPRAREASSPSTPSSTASSPTGTTWRKSGTTPSTMSCVWLPRSTPCCPRPPTPRPTARRP,SPWMMISPRSSSTTAPACARPASRATMPPGPSSPPSWGAPGTRGSWLGGAAPGAGGRQGRFLCTGASRFPGWGLRPCSGLLVLSFPGRDGGHGSEGFLCGRRGPEQERHPHPEVPHRARHRHQLGRHGENLAPHLLQAACGSRGAPRAADRGPPEPQGQPREDDP,HHGYRRARRRQRLRHVQGRLRGRRCPPGRLPLHRGAPQAPGRGAGWVGQPRERAGGKGAFSAQEPPGFRGGGCARAQGFLSFPSQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ