McDonnell Genome Institute

Washington University

CircRNA

chr7|5528003|5529663|-|ACTB|ENST00000493945.5

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9205

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

30

3

Peptide

SYELPDGQVITIGNERFRCPEALFQPSFLGEWR

Amino Acids from 5' Exons

IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGEWRLSPGSAHEGYPSGLCCGSVLPSFPSQAWSPVASTKLPSTPSSVTWTSAKTCTPTQCCLAAPPCTLALPTGCRRRSLPWHPAQRS,SCLRPSTPQPCTLLSRLCYPCTPLAVPLASWTPVTGSPTLCPSTRGMPSPMPSCVWTWLAGTLTTSRSSPSAATASPPRPSGKSCVTLRRSCATSPWTSSKRWPRLLPAPPWRRATSCLTARSSPLAMSGSAALRHSSSLPSWVSGDCLPALPDMRVTPRGCAVEAKSCPHFPLRHGVLWHPRNYLQLHHEVRGHPQRPVRQHSAVWRHHHVPWHCRQDAEGDHCPGTQHNEDQ,HVDLQHPSHVRCYPGCAIPVRLWPYHWHRDGLRRGHPHCAHLRGVCPPPCHPASGPGWPGPDLPHEDPHRARLQLHHHGRAGNRAHGEAVLRRPGLRARDGHGCFQLLPGEELRAARPGHHHWQAVPLPGTLPAFLPGVETVSRLCLTGLPLGAVLWKLSPALISLSGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK

Amino Acids from 3' Exons

LTMDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ,SPWMMISPRSSSTTAPACARPASRATMPPGPSSPPSWGAPGT,HHGYRRARRRQRLRHVQGRLRGRRCPPGRLPLHRGAPQAP