McDonnell Genome Institute

Washington University

CircRNA

chr7|5374054|5378024|-|TNRC18|ENST00000399537.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9952

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

EAPSPFQALFSGHGR

Amino Acids from 5' Exons

QERLKAQEHRAEMEEKGSKRGLEAAGKAGLATAGPGLLPRKPPGLAAGPAGTYGKAVSPPPSPRASPVAALKAKVIQKLEDVSKPPAYAYPATPSSHPTSPPPASPPPTPGITRKEEAPENVVEKKDLELEKEAPSPFQALFS,RSGRRRSTGRRWKRRGASGAWRLRARLAWPPPAPGCCRGSPLAWPPAPRAPTARPARHHHPAHPLWLPRPRSSRSWRTCPSHPPTPTPPPPAPTPPARRPPPHRPPRVSPARRRLPRMWSRRKTWSWRRKPPAPSRPCSQ,GAVEGAGAPGGDGREGEQAGPGGCGQGWPGHRRPRAAAAEAPWPGRRPRGHLRQGREPATITPRIPCGCPEGQGHPEAGGRVQATRLRLPRHPQLPPHQPAARLPTAHPGYHPQGGGSRECGREERLGVGEGSPQPLPGPVL

Amino Acids from 3' Exons

GTAEQMRTVWTTGPDTGRNGCSGHGWTGIRRSCS,ARPSRGLCGRPGQTPGGTAARGTAGPGSGEAAQ,HGRADEDCVDDRARHREERLLGARLDRDQEKLL