McDonnell Genome Institute

Washington University

CircRNA

chr7|5227179|5229738|+|WIPI2|ENST00000288828.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9901

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

SPPPGPGTSGK

Amino Acids from 5' Exons

TPRGAHHLDRVLRESAHGLHQLPAFPSDRNVQPGQSLRHGPPAILRPQKHLLASH,PPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLA,PQRSPPPGPGTSGKCSWPPPATCLPKQKCSTRAEPSPRSACHSAATKTSARP

Amino Acids from 3' Exons

AGRQSGNDQDLGLCLSRLPLSHSDIRRSCRKRYLRAFIPNET,LDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRL,WTAVWKRPMRSWTLPLTTAPSLRHTAQLQEKVLTCLHPQRDL