top of page

McDonnell Genome Institute

Washington University

CircRNA

chr7|51043382|51043692|-|COBL|ENST00000265136.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9263

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LSGLAAGQHEIQR

Amino Acids from 5' Exons

ACPWGLAATAARMEPRRCCQRRRRPCQLAAVLRRRTRPRTQEVPPQTSSLWTRSRTANTKTSGPQTRKTAVTRTSLEPQTWVPRRAPCGRRMALRTHI,KPAPGVWQPLQPGWSPAGAVRGGGDRVSWQLFCVGGHDRGLRSDEFPLRHRLSGLAAGQHEIQRQVGHRPGRLQPGPRWNPRPGSPEEPLVGEEWLELTSE,SLPLGSGSHCSPDGAPQVLSEAEETVSVGSCFASEDTTEDSGVMSSPSDIVSLDSQQDSMKYKDKWATDQEDCSDQDLAGTPDLGPQKSPLWEKNGSENSHL

Amino Acids from 3' Exons

ACPWGLAATAARMEPRRCCQRRRRPCQLAAVLRRRTRPRTQEVPPQTSSLWTRSRTANTKTSGPQTRKTAVTRTSLEPQTWVPRRAPCGRRMALRTHI,KPAPGVWQPLQPGWSPAGAVRGGGDRVSWQLFCVGGHDRGLRSDEFPLRHRLSGLAAGQHEIQRQVGHRPGRLQPGPRWNPRPGSPEEPLVGEEWLELTSE,SLPLGSGSHCSPDGAPQVLSEAEETVSVGSCFASEDTTEDSGVMSSPSDIVSLDSQQDSMKYKDKWATDQEDCSDQDLAGTPDLGPQKSPLWEKNGSENSHL

bottom of page