McDonnell Genome Institute

Washington University

CircRNA

chr7|51027711|51219944|-|COBL|ENST00000265136.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9743

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

MVPSGPVSLLPTTTGK

Amino Acids from 5' Exons

KWKTAMKQTPAPSPAPSMVHPTTAHRMPSLTATQMQSQHSGKFQMILWIRGCFPIETTMLGLSTRRVLPAGETPWRHFKLSTASPMKRQGRKYLPCTPLPMTSEKESVWPYLTSLKMGIWKRRPGLLLLRIFTQTTMQKKTKCMAVLTGRGLKPQREIPNRMKRTATIKTLPWHQHHGTNEAKTQGKATDLSTASQRIKSFLQSQRCDVTTEMCPSPPEPLRLTSWGTWVLTPPASGSFPCLRLCLKQNLSPLGKSESSGGATLWKNTWADPQRALPGDPPPPLCPRRRRIQRADSKQTPSQYRPSRSLPTMRAGTPGRGETSPPPWAWVTGCQQLTPQKSHFSSLREERPASMWPLPLPSAEPQKSMLMWGHTVMPRRVMQARRQCWLHHLSLKMTGHPAHTQRHKDGRMVPSGPVSLLPTTTGKIWQWEPLLGGRSLAHTGSCLLRTDLLLSTEAPVSHWFSLPRGIVFLWDRAVVSVESKAQVARRPAQHLSPDAHLMVQTHPLHTHLTLRPAAGSWSMALCAPQATASLPTLQEGLAQKATFSKERKSPVCSLQMEMKQTVFGHPAFLGRRKNSNLLSRDQSQKTHPCTLPWKPSTLREGRTDYA,NGRQLNRHQLPHQLHPWCIQPLPTGCHDPSRRHRCNPSNIHRGSFRSCGFGVVFQKQQCWVFRLGGCCQQERLPGATSSAQPAPKGKGGSTCPAPRFPRRKRNPCGLIHLRWESNGNGAQGDFFCFESSHRQPKCKSERQSVWLCRGEDSSHRESEFPTGEKGQQRKRCLGTNIMAPTRPKPREKLQTARPHNVNHSSKVRDAMLRQRCVPLHRSHDRAGELGESSRHRHQDHFPVFVCASRISAHWESQRVLEVQLCGKTPGPTLRELCQGTPLHPCAHADAESREQTPSRPQANIAPAEVCPPGPEPPRGGEKPAPHHGHGSREGASSSHHRSHISQASEKNVQPVCGLCHCQAHRSPKSPCCGEATRLCREGLCRQGASAGCTTCHCERQDIQPTLRDTRMEGWCPVALCHSSQQPRGRFGSGSPSGGGHWPTQEVVYSGQTCCYPQKLLFLTGSVFPEGSCFCGTELWFQWKAKHKPGGQLSIAQTRTWYRPTPSTHIHSGLQQGAGQWLCARPRPRRAFPPSRRVWHRKPHSPRKRGKAQCVLYRWKNRQYLATQHFWAEEKIQTCCPETSPKRHIPALCPDGSHPLCGREGQTTQ,MEDSYETDTSSLTSSIHGASNHCPQDAMIPHGDTDAIPVTFIGEVSDDPVDSGLFSNRNNNAGSFDSEGVASRRDSLAPLQAEHSQPHEKAREEVPALHPASHDVGKGIRVALSNISKDGNLMETAPRVTSFASNLHTDNLNAKVKDKVYGCADGERTQATERVNSQPVNEKDSNDKNAALAPTSWHQRGQNPGKSYRLKHGLTTYKIIPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHATGIRIISLSSSVPEAESQPIGKVREFWRCNSVEKHLGRPSESSARGPPSTPVPTQTQNPESRLQADPKPISPQQKSAHHEGRNPLGEGRNQPPTMGMGHVRVPAAHTTEVTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRPHGYAEKGYAGKAPVLAAPPVTVKDDRTSSPHSETQGWKDGAQWPCVTPPNNHGEDLAVGAPPRGEVIGPHRKLSTQDRPAAIHRSSCFSLVQSSQRDRVSVGQSCGFSGKQSTSSQEASSASEPRRAPDGTDPPPPHTSDTQACSRELVNGSVRAPGHGEPSHPPGGSGTESHILLEREEKPSVFSTDGNETDSIWPPSIFGPKKKFKPVVQRPVPKDTSLHSALMEAIHSAGGKDRLRK

Amino Acids from 3' Exons

EEDEGSCSPTSWKGCHSACAQPEAPPRWGPRVAAELGSHEGGAEGQHHGRHRGPAWAGEEERAQWE,RKMKARAPPPPGKAATLHVHSDQKPPHDGALGSQQNLVRMKEALRASTMDVTVVLPSGLEKRSVLNG,GRRLVLPHLLERLPLCMCTVTRSPPTMGPSGRSRTWFARRRGPAPWTSPWSCLVGWRRGACSMG