McDonnell Genome Institute

Washington University

CircRNA

chr7|47965299|47978816|-|HUS1|ENST00000458191.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9717

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

MGEAAGISNMIAK

Amino Acids from 5' Exons

ILITRWCILICFMKTCPFSISSLRCPSTLSLELACRDFVRMGEAA,YCEQDGAFSASRRVPSVFHPCAVLAPCRWSWHAETLSGWERPQ,IVNNKMVHFDLLHEDVSLQYFIPALSHPVAGVGMQRLCQDGRGR

Amino Acids from 3' Exons

ESVTPSLPKPAPSASALISLTSSFVTSWLMEEACGVSWN,NQHDSQACQNLHPPHQPALHPLQAGWRSEHVVAGT,ISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ