McDonnell Genome Institute

Washington University

CircRNA

chr7|47792626|47827468|-|PKD1L1|ENST00000289672.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9821

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

5

Peptide

TEESPLVDISSYQAAEVLAAR

Amino Acids from 5' Exons

NYYLDEFANLLDELLMKINGLSDSLQLPLLEKTSNNTGEARTEESPLVDISSYQAAE,ITTWMNLQICTNFRLMVCPTAYNSPFWKKHPTTQGRQGQKRVPWTFLVTKLL,LLLGICKSVRRTSDEDWFVRQPTTPPSGKNIQQHRGGKDRRESLSGHFLPSC

Amino Acids from 3' Exons

VLAARQQARHLRWAHPPSKAQLRGTRQRMRRESRTRAAL,SWLPDNKLATCAGRIHHPRPSGAPDRGGERVAHGLP,LGCPTTSSPPALGASTIQGPAEGHQTEDEERESHTGCPE