McDonnell Genome Institute

Washington University

CircRNA

chr7|4740837|4741023|+|FOXK1|ENST00000328914.4

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9655

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

SMVSPVPSPTGTIR

Amino Acids from 5' Exons

VYLPVSQHGHQDPVHVALSQRRGPSLPAAATVPPDLPSEDPHPGAGPPEHGQPRPLPDGHHQ,CTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSMVSPVPSPTGTI,VPSGFPARPSRSSSRRSITKKRPQPPRCGHCTPRSPLRSTSRSRTSGAWSAPSPPRRAPS

Amino Acids from 3' Exons

VYLPVSQHGHQDPVHVALSQRRGPSLPAAATVPPDLPSEDPHPGAGPPEHGQPRPLPDGHHQ,CTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSMVSPVPSPTGTI,VPSGFPARPSRSSSRRSITKKRPQPPRCGHCTPRSPLRSTSRSRTSGAWSAPSPPRRAPS