McDonnell Genome Institute

Washington University

CircRNA

chr7|45108931|45109287|-|TBRG4|ENST00000478532.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9413

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

24

Peptide

ATRPEELLELLGGSHDLDSNQAAMGLESLAR

Amino Acids from 5' Exons

GLESLARSLVSLPPRTSWQLTWSDARASEKLLVRPLPWLQLADDLPGPIRLLPQPPHPFPTSQVPWSRWRRNEHLLPTRSRWTTSSRRPQGQRSSWSYLVAVTTWTAIKQQ,VWNHLLGVLSLCHPGHHGSSPGKAMHVPPERSCSSGPCHGSSWPTETCLGSPDSDFLSHLTHFPPPRFLDGAGGEGTSIYSLHREAGGPPHQEGHKARGAPGATWWQSRLGQQSSSN,FGITCESCLSATQDIMAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAM

Amino Acids from 3' Exons

GLESLARSLVSLPPRTSWQLTWSDARASEKLLVRPLPWLQLADDLPGPIRLLPQPPHPFPTSQVPWSRWRRNEHLLPTRSRWTTSSRRPQGQRSSWSYLVAVTTWTAIKQQ,VWNHLLGVLSLCHPGHHGSSPGKAMHVPPERSCSSGPCHGSSWPTETCLGSPDSDFLSHLTHFPPPRFLDGAGGEGTSIYSLHREAGGPPHQEGHKARGAPGATWWQSRLGQQSSSN,FGITCESCLSATQDIMAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAM