McDonnell Genome Institute

Washington University

CircRNA

chr7|45038252|45073571|+|CCM2|ENST00000258781.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9151

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

15

Peptide

LSASATELLQDYMLTPGIVSPFK

Amino Acids from 5' Exons

PGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVK,LELSRHLNEYSKVKRVEIRKPMRRQRGALCTLWCCHCLSASSQTDCATILRRR,WNCLAITSIPKRKERESPEGDREAPSAHCGVVIAARRARQTAERLYEGGK

Amino Acids from 3' Exons

LLPICGCGWCITPQQDHQERAERQRHAAAGLHAD,CFPESVDVGGASPHSKTISESELSASATELLQDYMLT,ASLNLWMWVVHHPTARPSVRASAPAPLSCCRTTC