McDonnell Genome Institute

Washington University

CircRNA

chr7|44700140|44707736|+|OGDH|ENST00000222673.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9451

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

AKPVWTLK

Amino Acids from 5' Exons

DLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKP,TLKKPTSTSISYMTAIGLLSTAPLLATSSTCYDARSCCHSGS,PRSQLRHQSAILQLGCCQLLHSWQLLPRATTPDPAAIPEA

Amino Acids from 3' Exons

LSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRAKPV,CRHSPLTSCRRCRSTPMLSWPGARRSTRTKATMTTSQDFGPPSAAPSPS,VAIPLPPAEGGAEVPQCAGLVPGGAQEPRLLLREAKTSDHHQPRQARL