McDonnell Genome Institute

Washington University

CircRNA

chr7|4017170|4079584|+|SDK1|ENST00000389531.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9099

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

6

Peptide

WIVEGQVPPGWPSRR

Amino Acids from 5' Exons

VPPGWPSRRVPAAEHHQPGGELLPGDRPDHLDTVDTGGGVQRGRSGRLQQGSDRVHLAG,YRLAGLPGEYQQRNITSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQG,TAWLAFPESTSSGTSPARRTTAWQTSSGHSMRYRWRRTTGPVWASSAGQPSTPCRE

Amino Acids from 3' Exons

TFLVPHPTWSFPTSALAPPPFSSGQAMTGKRPSPGGLLRG,PSWCPIQPGHFQHQPSLRHPSVPARLRENVHLQVDCGA,LPGAPSNLVISNISPRSATLQFRPGYDGKTSISRWIVEGQ