McDonnell Genome Institute

Washington University

CircRNA

chr7|33344580|33534176|+|BBS9|ENST00000242067.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9527

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

16

Peptide

LCLSTDAAAPQTMVMPASDR

Amino Acids from 5' Exons

QATDVEVGTDLVPSVTVK,KRPMLRWELTLSLLSR,SDRCGGNPCPFCHGE

Amino Acids from 3' Exons

GWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMP,AGKKRWMPPFPTCRLACRRVLRSRLTSTASTYPKTQANRNISPCSAIDYPKVAVSAVPMQQPHRPWSCQ,LGRNGGCRHFPPVEDLPVEEFGAGFEPQQPAEHTQRHKPTEETYHLALRIIQRWPSLPKYRCSSPTDHGHA