McDonnell Genome Institute

Washington University

CircRNA

chr7|30615895|30628669|+|GARS|ENST00000389266.7

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.954

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

YLNIHSMYEK

Amino Acids from 5' Exons

RIHNGRNALCRSQERPPQVPECGRPSPLFVFSKSPGQRTVRSENAPGRCCT,EFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQ,NSQWQKLSTLIPVRKTTPSSRMWQTFTFICIQQKPRSADSPLGKCAWEMLLN

Amino Acids from 3' Exons

WKKLFRMLNLPSAWVGSCIRYLNIHSMYEKEMNRE,GRSCSECNTFLRPGDHVYGITYIPCTRRRTEN,EEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRT