top of page

McDonnell Genome Institute

Washington University

CircRNA

chr7|30615895|30622462|+|GARS|ENST00000389266.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9928

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

GEFTMAEIEHFVDPSEK

Amino Acids from 5' Exons

RIHNGRNALCRSQERPPQVPECGRPSPLFVFSKSPGQRTVRSENAPGRCCT,EFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQ,NSQWQKLSTLIPVRKTTPSSRMWQTFTFICIQQKPRSADSPLGKCAWEMLLN

Amino Acids from 3' Exons

KTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEK,KQSMLFSLNPVREQLVRHIRRMQNWWSILPFVMSATLQKWRCCMRK,NSQCCSVTQGSNWGIEGCKTGDGVSCHLVLHYRNGDAAEER

bottom of page