McDonnell Genome Institute

Washington University

CircRNA

chr7|29943976|29969068|-|SCRN1|ENST00000242059.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9616

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

16

Peptide

ESHRMAAAPPSYCFVAFPPR

Amino Acids from 5' Exons

AWFRKRGNSRSLRCHCLLVGRTWTRWELLRCKLLPQLPKCISDCGSSLGARDHREVLGCRESH,LGLERGETAKEALDVIVSLLEEHGQGGNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVT,LVKEGKQLKKPMSLSPCWKNMDKVGITLKMQTPATASKVHILWIVMKPGCSRPGSTGLPRKSQ

Amino Acids from 3' Exons

DGCSSSKLLFCCLPSTCGWSGGIWEKFSPAQRSARGCVFLGCSRTGEQG,MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVE,WLQLLQVTVLLPSLHVLRMVWWYLGKIQPGPEMKCKRLCISRLLITNRRARL