McDonnell Genome Institute

Washington University

CircRNA

chr7|29936555|29969068|-|SCRN1|ENST00000242059.9

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9279

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

IQPGPEMK

Amino Acids from 5' Exons

KASQCRLTPYGTKPAECATLSFSSPQPVECLSCRRIEALRAFTTSLEPLILP,KHHSADYDEHLTGQSQRSVHRLVFPHHSQWSVCPAAEKLSVHSLLHWNPSFQ,SITVQTMMNTLRDKASGVCIDSEFFLTTASGVSVLPQNRSSPCIHYFTGTPDPS

Amino Acids from 3' Exons

DGCSSSKLLFCCLPSTCGWSGGIWEKFSPAQRSARGCVFLGCSRTGEQG,MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVE,WLQLLQVTVLLPSLHVLRMVWWYLGKIQPGPEMKCKRLCISRLLITNRRARL