McDonnell Genome Institute

Washington University

CircRNA

chr7|29030576|29072423|-|CPVL|ENST00000265394.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9286

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

QAGDFHQSYAGK

Amino Acids from 5' Exons

VLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQ,FSTMANWTSSWQLPQSAPWAWTGKDPRNTRRQKKKFGRSLNLTVKWLVTSGKRVTSI,SDLQWPTGHHRGSCPDRALLDGHGLERIPGIQEGRKKSLEDLIQSGWLHPASGLPS

Amino Acids from 3' Exons

SYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPES,LMQGNMCQPLHTSSIPSTLERRSTTELLLEMDILIPN,LCREICASHCTPHPFPQPCERGEDQPERNCYWRWIFSRI