McDonnell Genome Institute

Washington University

CircRNA

chr7|2794927|2795143|-|GNA12|ENST00000275364.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

SEFQLGSRVLVDAR

Amino Acids from 5' Exons

GSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQL,AQGFLLMHEISLAFLGSILKMRSMGCSWPSRTRRGCLWSRPPSSCTSRPAHSGGILASGRLSAGEASFS,LKGSCCTRAWHSLAVFKEAWDVPDGLREQGGAACGAGHLPAVRPGPERTLEGFWHQGGFQPEKRVSA

Amino Acids from 3' Exons

GSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQL,AQGFLLMHEISLAFLGSILKMRSMGCSWPSRTRRGCLWSRPPSSCTSRPAHSGGILASGRLSAGEASFS,LKGSCCTRAWHSLAVFKEAWDVPDGLREQGGAACGAGHLPAVRPGPERTLEGFWHQGGFQPEKRVSA