McDonnell Genome Institute

Washington University

CircRNA

chr7|26193574|26197732|-|HNRNPA2B1|ENST00000354667.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9097

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

VGATEVVMTTMEER

Amino Acids from 5' Exons

VAILEVAPVMEEEEEDMVVEDLDMATRVGATEVVMTTMEE,WQFWRPRLWRRKRRIWWWRTWIWQPGWGLRRWLQLWR,GNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGG

Amino Acids from 3' Exons

REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCV,EKRNSSVSSLLVAALKPQKKVGTTTNNGESLQTV,RKGTVPALYWWLKLNHRRKFEELLRTMGKAYRLC