McDonnell Genome Institute

Washington University

CircRNA

chr7|26192494|26197017|-|HNRNPA2B1|ENST00000354667.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9875

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

LPWESGKPGAHVTVK

Amino Acids from 5' Exons

ETMVQEAVEEVGVMVGGADTELLPICH,KLWSRRQWRKWGLWWEEPILSFFLFAM,NYGPGGSGGSGGYGGRSRYASSYLPW

Amino Acids from 3' Exons

ESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIV,NLENQGLMLRSCLLAELKKILRNITLEITLRNMEKLIPLRLLIGSLERKEALALLLLMTMILWIKSY,IWKTRGSCNCEEAVCWRNRRYGTSPRLLGIWKNYHDNYAVWKEKRLWLCYFPSCGNR