McDonnell Genome Institute

Washington University

CircRNA

chr7|24834485|24849176|-|OSBPL3|ENST00000313367.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

MALAQNTDLK

Amino Acids from 5' Exons

GLSLIVVGKRSPGEERACRRPARAAVTSACGTSGTTSGRTCPRWPCRWSTSPTRCRGSARSWSTASSWTRPRRFPAPWKG,ACPWSGSEVPEKNVPAGALPEQQHQPVEHPEEQHREGPVQGGHAGGAERAPEHAAEALRGAGVQRAPGQGRADSQPPGKD,PVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERM

Amino Acids from 3' Exons

ALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAE,PHKTQILKNAYAESMPSLCSSTPPLSPSRVTIWQ,PSTKHRSRTLTQNPCRVSAPRLPRCRQVGQSGR