McDonnell Genome Institute

Washington University

CircRNA

chr7|24804314|24834736|-|OSBPL3|ENST00000409452.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9499

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

WSTSLGFSGPVLDSGR

Amino Acids from 5' Exons

VSRGRELRRSNTKAEDTTAERKAAGLRRKSCGAPASVFQ,FLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFF,FRKGTKKLKYKSRGLNNCREKGGGSKKIMWSTSLGFS

Amino Acids from 3' Exons

GLSLIVVGKRSPGEERACRRPARAAVTSACGTSGTTSGRTCPRWPCRWSTSPTRCRGSARSWSTASSWTRPRRFPAPWKGWGVSLPLPLSSLGPQATRPFTGPIRETAPVPSGFILIVPTGSLLRAVWLPPPGCFQSPCEDLETGLGCFSVALGAWGSSVLWVCASSFSRSLLADCSDVPGWKTCLGCLHVYFYFPGWTEFNFSSCFSHP,ACPWSGSEVPEKNVPAGALPEQQHQPVEHPEEQHREGPVQGGHAGGAERAPEHAAEALRGAGVQRAPGQGRADSQPPGKDGEESAFPCHCPASVPKPRGHSRGPSERQPLFPPVSFLFRKQVHYSELSGFLRLAVSSHLVRIWRRGWGASPWHLVPGVVLFCGFVLPLSPEAFWLIVPMCPAGKHVFRAVCMFIFTSLGGQNLISRAVFLIQ,PVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERMVRSQPSLATVQPRSPSHEAIHGAHQRDSPCSLRFHFDCSVNRFITQSCLASSAWLFPVTLGFGDGVGVLLRGTWCLGFCSVGLCFLFLQKPSGLFRCARLENMSLGLSACLFLLPWVDRIFLELFFSSR