McDonnell Genome Institute

Washington University

CircRNA

chr7|23140768|23168037|+|KLHL7|ENST00000339077.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9185

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

13

Peptide

VLNSCEVYDPATETYK

Amino Acids from 5' Exons

VVCRSVIVLNKQLQMTLFISTLLKFTKLMNFFNLMSSEHIFSTRTLLEQRI,YKCASGVSRLSIESNCRLYSSALYSLQNISSTCQASNTSSQPGHSDCESRGS,ISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLNQDTLTVRAEDQ

Amino Acids from 3' Exons

ETQLCIYLSAMIRELKAGTQSPACPSAAAMGWWKPMASMFVVEVETMFLGECLIPVKFMILPQK,KLSSVFIVLYENKLAHKAQHADPALQPWDGGSQWPNLCLWWKFRKQCFWESAFLSLSCHRN,NSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATE