McDonnell Genome Institute

Washington University

CircRNA

chr7|2271849|2275229|-|SNX8|ENST00000222990.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9954

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LFLSFSGSR

Amino Acids from 5' Exons

LTGSSSRPGGEPSASSTWWRDTPCSPRMWSSSSSCPSAA,QGVHRGQEESPEALRQPGGATPPVLRGCGPQALPVLQRL,DREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGS

Amino Acids from 3' Exons

RFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLG,ASSPRYTDGTMTSWSSRRCSCTSSPTVWCLPCHPRECWE,LQVLGIQTVQLRGLPGDAPAQVPLPYGACPATQENAG