McDonnell Genome Institute

Washington University

CircRNA

chr7|2256873|2278305|-|SNX8|ENST00000222990.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9128

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

LPAPGDAAHPR

Amino Acids from 5' Exons

QENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVNSQIQGHKE,RRTRFRRWSCGTTSPCTACTRRRSSSTSTCPSPPTSSAPSSTLRSKGTR,GERDSDDGAAELLLPVLPAPGDAAHPRLPAPHLPHPPRLRQLSDPRAQG

Amino Acids from 3' Exons

ICRHPRPSSPRPSCSRSQPPVECRCRRGTRCCCPTPCRSCWPGTPCRWSSFRRRRASSSMWSMRFPA,SADTPGHRAPGHRAAGPSPQSNADAAGEPAAAVPHPAGAAGQGHRAGGAHSGEEGPLPEACGVGFQP,LPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQ