McDonnell Genome Institute

Washington University

CircRNA

chr7|20363636|20379297|+|ITGB8|ENST00000222573.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LETIYLEK

Amino Acids from 5' Exons

KTIDVHLQMQHPVPGALRWVQNVDGVFK,RQMCIFKCSILCQVPCAGSRMWMVCSR,DNRCASSNAASCARCLALGPECGWCVQE

Amino Acids from 3' Exons

EPKLILCKFILRNILWIFIILLMSQHQCTIIKNIPLETIYLEKWHFSPVTFVLDLAHTLIKQFHHTLASTPKGFIINA,SRSFYAESSSSEEISCGSLLSCCLSINAQYRKIKFRWKRFIKNGIFLPLSSWIWLIRNSFTIHHPPRKDSSMQ,AEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQC