McDonnell Genome Institute

Washington University

CircRNA

chr7|20154192|20160245|-|MACC1|ENST00000332878.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9212

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

GNTGDVAVENAR

Amino Acids from 5' Exons

ALLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEIPHRGNTGDVAVE,LFKWIAKSSHVSSKKLLFLQLSSLEKAGGNLKSYDSQSNKWRHMKFLIEETLEMLLL,SSENGLPRVSRTSHPRSCCSDFSCQAWKRLEGTSKVSTTHKATNGGINSSSRKHWRCCC

Amino Acids from 3' Exons

NARTQTCFTIGRMLSPFVVIMLPKLQIHSGINCLLLTHFWMTLNEITGREIIFPSRKILFFSVEKKMEILLIPPVMNLMCISYLGRLPQEILEDLKVFQNFWTFTTQHMPIRVYITLTRSYYTTSGLKMIGRLIKWLGVNASWPAPALIIQLVRALDGPRHNLRRSPLAKTIKEGQYNYLNQTSLFMCPKVMWLWENSKRCLGLSLIRHTCLTMIFRALARCWKSCATSIQWKPFCWRKLGLKERILSAKSQKWCVYTAWVKKALLKFATATFIKTPSKSSSTVRCIWLLHKLKLFRHQLPPFGIISTKPPQLEFMDPNISIPVLLLFQFVDTIICQDSLQFLILRRVEKTYLQLCFSSGGSSHFYLTSHKIVFLFFPVILILKRQKEKGKKLNKSSWKQVKFINNFYFLLSTERCTCLIFVFKWSLPMVNQLHSSLSLLLIQPQTKDSRICQAICRRRRKSSLLLYHQKFLLNILHFKIKHTLATMGPRQCDKARLITSLNISKGTQLSSGKVRKLLVSPKKNGMESSEVRLDLYTAKMSRFQRSKCLCQIVSLQPEIFLNRLSCLKNLISTQLYPWCQKKFMIGKFLMSWVTHICPWKILIKFKQTKNQRKFLMLRSRKIATQREIQGSFCMNLL,MPGPRLASQLAGCFHPSWCFQSCKSILESTVCFPIFGHNSTKKQEEKYFHLKGRSFSFLRNRKWKFFFLRTCASVTADFLKKFWKIKCFRTSGHFRRHSTCPSEYTLPDPTTRLRVAKSGGLNGLVKSTPAGPLLPFEYNSEPWMGPDTTCGGHHSLQSKPSRRVSTITIRHHCSCAPRSCGCGRIPRGVSKGFPSATHAPSFVHCEPVVGNHVRQPQYNGSPFAGDENWGSKKGSFQPSHDRNGVFTQLGRRPFSFKQLLHLRHHPSQANRLESGNVSSGCCTSSSSVTSCHHLGLYPQNHLNWNLWTQIYPSQFYCCFNSLWTQLYARTAYNFYEGWKKHISSCVSALGEAVIFTQATRFKYFYFFLSFSKDRRRKERNTKAVGSRSSSSTIFIFFSAQRDALVFLCSSGASQWTSCTVLYHYSSNPKPKKTLESARLFAEEGGNQVCSFITKNSCISYISRNIELQLWGNPEGSAKTKQDLLPIFQRGHNSSPRGRGKSYWSVQSERMVCRSPQRDWTCTLQKCQGDFKGASNVYVRCLYNQKSSTDCPAFKKIDLYLLSCINLGVRKSLLESFSCPGLLTSVPGRFSNSSRQRIRESFLCYKEVKGRLPHREKYKEVSVTYC,CQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPFLDDITQLRNNRKRNNISILKEDPFLFCREIENGNSFDSSGDELDVHQLLRQTSSRNSGRSKSVSELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWLSQRQLARSCLDLNTISQSPGWAQTQLAEVTIACKVNHQGGSVQLPESDITVHVPQGHVAVGEFQEVSLRAFLDPPHMLNHDLSCTVSPLLEIMLGNLNTMEALLLEMKIGAEVRKDPFSQVMTEMVCLHSLGKEGPFKVLSNCYIYKDTIQVKLIDLSQVMYLVVAAQAKALPSPAATIWDYIHKTTSIGIYGPKYIHPSFTVVLTVCGHNYMPGQLTISDIKKGGKNISPVVFQLWGKQSFLLDKPQDLSISIFSCDPDFEVKTEGERKEIKQKQLEAGEVVHQQFLFSLVEHREMHLFDFCVQVEPPNGEPVAQFSITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKYPTFQDKTLNFSNYGVTLKAVLRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVGVLRGKIGLVHCKNVKVISKEQVMFMSDSVFTTRNLLEQIVLPLKKLTYIYSVVLTLVSEKVYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKLKEDCHTERNTRKFLYELIV