McDonnell Genome Institute

Washington University

CircRNA

chr7|1936686|2149238|-|MAD1L1|ENST00000265854.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9704

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

EVAGLQK

Amino Acids from 5' Exons

GDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVA,VTMTRAGPKCCTATPPVWPGSACARTTASCRRSASDCAGSCAPWREEAPSQPTLRLPPRVCHRPRRWQ,LPEQDQSAAHEPEPHQCGQAAPARGPQPAAGGVRATARAPARHGERRHRPSRPGCRRESAIVQGGG

Amino Acids from 3' Exons

DSRRPFQIRGAAAEGACLEGQEQRRHQQ,TPEDLSRFVVELQQRELALKDKNSAVTS,LQKTFPDSWLSCSRGSLPRTRTAPSPA