McDonnell Genome Institute

Washington University

CircRNA

chr7|1898199|1957719|-|MAD1L1|ENST00000265854.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9124

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

VEGRGAGRR

Amino Acids from 5' Exons

SRSRWRVPSRTSGSRRFSRPRSRSSARPATRSPATRSTSPRRTSTGPRCTPSTQATASSS,AEEAGGECRAEEPAAQGGFPDQDPGVPQGLLHAHRLPDRHHHGEPVPADLAVRRAPRRLPHLQ,LKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFK

Amino Acids from 3' Exons

VEGRGAGRRAESAGGGKEDAGGTAGAASSA,LKVEELEGERSRLEEEKRMLEAQLERRALQ,RSRSWKASGVGWRRKRGCWRHSWSGELC