McDonnell Genome Institute

Washington University

CircRNA

chr7|18591515|18629481|+|HDAC9|ENST00000405010.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9275

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

MFEVTGAVASTEVK

Amino Acids from 5' Exons

GQWQVQKSRSFKSSYVNQQRKTLQLMEKIIPAAIPSSGT,GSGKYRSKAEASRVPTEISNERHSNWKKSFREPPSQALVH,AVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWY

Amino Acids from 3' Exons

PLSPTRCGPGNRKWQRGEAAPYSGGRMEMLSLHSRSECLRQ,LAQLEGAVQVKTESGREEKQPLTQAEGWKCCHFIQEANVGD,SEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVT