McDonnell Genome Institute

Washington University

CircRNA

chr7|16308522|16406337|-|ISPD|ENST00000399310.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9351

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

LTSGRVCWIK

Amino Acids from 5' Exons

CSDYDLEFGTECLQLALKYCCTKAKLVEGSPDLWK,VVTMTWNLELSVCNWPNTVALKPNLKDHLTSG,LLGIWNVFAIGPKILLHSQTCRRITPLE

Amino Acids from 3' Exons

SMLDKGHCCGSNWREHGSNEKYYSEVSATHLTGRSWSDPPQVNFQWTKSTGRRSDQLTLARSSDYPCCETICGRCPSSCHSCGTR,VCWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAEDQINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHG,YVGRTLLWQLERTWKKVLFRSISINASHWSKLEPATGQFSMDKHWQKIRSTLNSLSQKLSMMLDHLLRKVSFLKLSQLLRNT