McDonnell Genome Institute

Washington University

CircRNA

chr7|157595237|157656551|-|PTPRN2|ENST00000389413.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

52

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

SPAPPHAAAPHPGPR

Amino Acids from 5' Exons

MDHDPRNPAYIATQGPLPATVADFWQ,WITTRGTPRTSPPRDRCPPPWLTFG,GSRPEEPRVHRHPGTAARHRGLLA

Amino Acids from 3' Exons

ELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQSNMDISTGHMIL,SCAASVWPRGHQTDLRARTRHASAASHPSSATGRSPAPPHAAAPHPGPRSLCSPTWTSPPATS,AVPPAYGHAATRPTGPAHVTHQQRLIPVQRRADPQPLRTQQRLILVRGACAVQHGHLHRPHDP