McDonnell Genome Institute

Washington University

CircRNA

chr7|157182107|157225539|+|UBE3C|ENST00000348165.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9208

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

FLQPSQR

Amino Acids from 5' Exons

ATSFYSLHRGVSGSTFYRSDFSFHHSGACRCADRFPLRALSECTVVNREMFKKEWWSTLAFLFRFNCWRKLF,QQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNALLLIESRCSRKSGGAPWLFYFVLTVGENYL,NKFLQPSQRSFWQHLLQIRFFISSFRRLQMRRPFSLTSPFMHCCRVDVQERVVEHPGFSISFLLAKIIW

Amino Acids from 3' Exons

IFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPEN,SFRGFMQISKKFKEMVHFWMELMSQEEITFMKMLMTNFLQKM,LSEVDLCRARSSRRWSISGWNCHNKKKLHLRCLQTFSRK