McDonnell Genome Institute

Washington University

CircRNA

chr7|155711202|155745602|+|RBM33|ENST00000392761.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9851

40

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

5

Peptide

LSGGPQAPPPPPPPPQQQPIR

Amino Acids from 5' Exons

PQAPPPPPPPPQQQPIRSLFQPQPLQPLLPVQHPHHPSPPQGMHMPPQLETPRMMMTPPPVTPQQPKNIHINPHFKGTVVTPVQ,PRLPLHRHRRLSSSRSEACSSRSRCSRCFRCSTRTTHPRLRECTCLPSRPQGPRHPLHSSPRTYTSTRTSKGRWSRLFK,PGSPSTATAASAAADQKPVPAAAAAAAASGAAPAPPIPASGNAHASPARDPKDDDDPATRDSTAAQEHTHQPALQRDGGHACS

Amino Acids from 3' Exons

FPDEDEETRLYRLKIEEQKRLREEILKQKELRRQQQAGARKKELLERLAQQQQQLYAPPPPAEQEEQALSPSPTNGNPLLPFPGAQVRQNVKNRLLVKNQDVSISNVQPKTSNFVPSSANMQYQGQQMKALKHLRQTRTVPQSQTQPLHKVLPIKPADVEEPAVPQTPRVASIQGRPQDTKPGVKRTVTHRTNSGGGDGPHISSKVRVIKLSGG,FLMKMRKQGYIARKNRNAEKKSNRRSYGGSSRLVPGRRSCWRDSRSNSSSCTLPHPQQSRKSRHCHHHPPTVTHCCPFQVHRSDKMRTDFLLKTRMSVFQTFSPKHPILYHPVPTCSIKDNRKHNIDRPEQFLKVRLSRCIKCSRSNLQMWRSQLSPRLLEWRPSRAGPRTQSLAKGLSRTGQTVVVETGPTSAPRSGLSCQV,SRGNKVISLKDRRTETPKRRNPETEGVTAAAAGWCQEEGAAGETRAATAAAVRSPTPSRAGRAGTVTITHQRPTVALSRCTGQTKCEEQTSCKPGCQYFKRSAQNIQFCTIQCQHAVSRTTDESTETFETDQNSSSKSDSAAASAPDQTCRCGGASCPPDSSSGVHPGPAPGHKAWREKDCHAQDKQWWWRRAPHQLQGQGDAVRW