top of page

McDonnell Genome Institute

Washington University

CircRNA

chr7|154954254|154969126|-|PAXIP1|ENST00000397192.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.94

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

LILQTLSAPTK

Amino Acids from 5' Exons

KLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFI,SSTFLVERLRSLHRSAHTSLPAKLAPSSRRFLSSTRQSGWKNASGVRSSL,ALHSWWRGCGVCTEVHTPHCQQSDSHREVPDGDFCREAHSDARVAGRMLQVSEVH

Amino Acids from 3' Exons

ILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVE,SYRLFQHLRKINSRITASRDIQMPMQCCLAKKLQRHTCYSSSSRPSSSSSSTRFYTFSPSRCSSSSSSSSRSLSNLTPSSRRIHFHSNSSSSSKPIRISFHSNSYSFHSNSCILHSSCIALSSSSSPFSSSMPCSSSSISCSSTSSSSSSLPSSSSSTACSSSSSNSRFSSSSSSACTSSSSSSRCKVRQRHTVRRHRRCSIRFHLSSPRSSSSNSSHHHRLSSISFLDMIQQWR,LTDSFSTYEKFRTAGESQPAGTYKCQCSAVPSESDSRDTHATAAAAGPAAAAAAPGFTPSAPADNAAPAAAAAADLSATLPPAAAASIFTATAAAAASPSASVFTATATVSTATVASSTAAASPSAAAPALSAAACPAAAVPSAAAAPAPAAAACPAPAAAQPAPAAAATADSAAAAPAHAPAAAAAADAKSDSATLESDVTGAAASGSTSAAPAAAAATAATTIASAASAFWTSSSG

bottom of page