McDonnell Genome Institute

Washington University

CircRNA

chr7|152187261|152358675|-|KMT2C|ENST00000262189.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9082

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

EEFPDLEVGGK

Amino Acids from 5' Exons

GKFSLSNGKSQLLDIISSHCGRRKHNVECPEKHAVGERGGSGNGNCCPSSLHQYFPQLKGRIP,DKNSAFNPMASDPNNSWTSSAPTVEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFP,IKIQPLIQWQVILTTLGHHQLPLWKEKMTQCRMPREARLSGRKRRLWVKWQLLPQFSTPILISPTRKNSL

Amino Acids from 3' Exons

TSKGENCSGRGQHGWAGDNRNRNDCGN,PRSRGKTAVEDEDSMDGLETTETETIVET,LEVGGKLQWKMRTAWMGWRQQKQKRLWKQ