McDonnell Genome Institute

Washington University

CircRNA

chr7|152162116|152194128|-|KMT2C|ENST00000262189.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9684

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

QNPAEGLSLAEK

Amino Acids from 5' Exons

IRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNELLKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGL,FVNNRKNMLNLKIIGSNSSSNVQWPHLPCPVSSPSHPFQVPLHPPANPPFPWCHSSFSTSSTQQLFLAILALLECPVYLDGNPTVLLPTCPSILLEFSPQLPSYQKLVHQPQGQSQMQIHRVDHHLGNLMTTIPLVKVFKNGNVRNVYENSKRDNGSNSCRRIDKELCSRGWKWSSMVWWALRVVVGHLCPRFPSTVPTYLVILCNLDPFSSLHNTNSKWGRFYSSRIYNKDQLIHPPPKLSCRLMSEGRALLHLFLIHHQSLLEAQIFLLSRDMEIFLGPASSSPQGLLLHLLYQQHLQLIAVSHVAKILLPMDTVIRDQPNRSFSCILISQRKKGKRKEQERRKEMMMQNPPRLHQLPIQILPHRLQASQKLPLLLQAHPVSFLNKPTKSRWNQSAHPLPIWQQASYVQNRTNCPIVISHKQLQINRRMQIQKTSSPWKPLPKQKRNWKRLRQSPAQAKRSLNWRNRMVVRKETLPVLSPQHRVLPILLGPLLPKETQGMNFNTCKIKSHLLFIKNLRAVFVQKMTVQRIINLRSRTQLKD,STTERTCIDRLSDQTAAAMCNGPTYHDAQCPAPATPNSRCHSTHHEPTHLSHGATAASAPAAHNSYFWPYPCNAQFTWMATQQCSCPPAPQSSNSAPNCPVTNKNLYTSPRDSLKCKSTEWTTTSGRIQQSLKFSRTGTGTFTRTARETTDPTHAGGRTKSFAAEDGNGAAWYGGLDKDICVPDSLLQFRLTLFYATSRTPSAVSTTPTANGAGFTAAEYTTRINFTLHPNFHADAKAGRPSFICSFTINPCWKPKFFFCEAGTWKSFWDQLPAVPSEAFFYTCFTSSTSSSQSPMWPRFYYNPWTQLSGINPIAHSVVFYNPRGKREKEKNKKEEKRCRIHQGSINSPFRYNCPTDSRHLRNYLYSCSEHTQASSTSRPRVGGTSRPIHSQYGSRPAMYRIREQTAQFLTSNSKSTDVCKFRSRQALHGNPCQNRRDKTGKGDRVLPRPRGAIGGTEWGRRKRCSLSCLLSTESSPFCWGPCCQRRLRETSETLVEKKVIFSFESKTGQYLFRRLYKGTSEAEPSRT

Amino Acids from 3' Exons

SLAEKMLKTYLQLYLVLRTLSQLHCHSLPHQHSCCQYTIR,AWRKRCRLIYSCTSCEHSANSIATASPTNTAVANTQS,LGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLLPIHNQ