McDonnell Genome Institute

Washington University

CircRNA

chr7|152162116|152167378|-|KMT2C|ENST00000262189.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.946

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

QNPAEGLMIHSVSSMK

Amino Acids from 5' Exons

IRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNELLKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGL,FVNNRKNMLNLKIIGSNSSSNVQWPHLPCPVSSPSHPFQVPLHPPANPPFPWCHSSFSTSSTQQLFLAILALLECPVYLDGNPTVLLPTCPSILLEFSPQLPSYQKLVHQPQGQSQMQIHRVDHHLGNLMTTIPLVKVFKNGNVRNVYENSKRDNGSNSCRRIDKELCSRGWKWSSMVWWALRVVVGHLCPRFPSTVPTYLVILCNLDPFSSLHNTNSKWGRFYSSRIYNKDQLIHPPPKLSCRLMSEGRALLHLFLIHHQSLLEAQIFLLSRDMEIFLGPASSSPQGLLLHLLYQQHLQLIAVSHVAKILLPMDTVIRDQPNRSFSCILISQRKKGKRKEQERRKEMMMQNPPRLHQLPIQILPHRLQASQKLPLLLQAHPVSFLNKPTKSRWNQSAHPLPIWQQASYVQNRTNCPIVISHKQLQINRRMQIQKTSSPWKPLPKQKRNWKRLRQSPAQAKRSLNWRNRMVVRKETLPVLSPQHRVLPILLGPLLPKETQGMNFNTCKIKSHLLFIKNLRAVFVQKMTVQRIINLRSRTQLKD,STTERTCIDRLSDQTAAAMCNGPTYHDAQCPAPATPNSRCHSTHHEPTHLSHGATAASAPAAHNSYFWPYPCNAQFTWMATQQCSCPPAPQSSNSAPNCPVTNKNLYTSPRDSLKCKSTEWTTTSGRIQQSLKFSRTGTGTFTRTARETTDPTHAGGRTKSFAAEDGNGAAWYGGLDKDICVPDSLLQFRLTLFYATSRTPSAVSTTPTANGAGFTAAEYTTRINFTLHPNFHADAKAGRPSFICSFTINPCWKPKFFFCEAGTWKSFWDQLPAVPSEAFFYTCFTSSTSSSQSPMWPRFYYNPWTQLSGINPIAHSVVFYNPRGKREKEKNKKEEKRCRIHQGSINSPFRYNCPTDSRHLRNYLYSCSEHTQASSTSRPRVGGTSRPIHSQYGSRPAMYRIREQTAQFLTSNSKSTDVCKFRSRQALHGNPCQNRRDKTGKGDRVLPRPRGAIGGTEWGRRKRCSLSCLLSTESSPFCWGPCCQRRLRETSETLVEKKVIFSFESKTGQYLFRRLYKGTSEAEPSRT

Amino Acids from 3' Exons

MIHSVSSMKSGSRRPNSCFKCSRSILKNKLVLTENLRRPFQLNNVLPRKLGVNFQRKMQNNSSMLLNSKAWFRNSN,FTAAVRVAPGDPTAASNAAEVSRTNWCSQKIEGPFSTTYCQESWAISRGRCRTTQACYTAKHGSETART,DSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKQLEQ